PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100203900091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 375aa    MW: 41397.1 Da    PI: 5.0794
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100203900091genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.8e-32171225155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+r+rWtpeLHe+Fv+ v++LGG e+AtPk +l lm+v+gLt++hvkSHLQkYR+
  Ote100203900091|100203900091 171 KARMRWTPELHEAFVDSVNKLGGCERATPKGVLLLMNVEGLTIYHVKSHLQKYRT 225
                                   68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575134No hitNo description
PROSITE profilePS512949.766168228IPR017930Myb domain
SuperFamilySSF466896.99E-16169225IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-30169226IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-23171225IPR006447Myb domain, plants
PfamPF002493.2E-8173224IPR001005SANT/Myb domain
PfamPF143792.2E-21256302IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MAPPSVKTSS ETDLSEMEAS GTTVGHLFSS VSGCPTRIHC SPLSPNTTHT LSPKAGASSV  60
ENRHPFSVMQ TTESNGYNME NNDVSWNEIE YFLDTPLKNS DQNGQLEWAD QLISVDDGTL  120
DANWSDLLVD GSLPDSELKL PDLPPNTSSH QPQFPQLPPH PLPNVNASSS KARMRWTPEL  180
HEAFVDSVNK LGGCERATPK GVLLLMNVEG LTIYHVKSHL QKYRTARFKP ESPEGTPGKK  240
PKTTSDMPSL DLKTTMEITE ALRIQMEVQK QLHEQLEIQR TLQIRIEEQG KRLQEMFEQQ  300
RKLEEEKGKA SSSNADRPQT PTTEKQPCIG NDKSQSSQIN SASTKESAAD VCISADEPKR  360
TKVDETAALG SPHES
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011102128.11e-116PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ8GUN52e-72PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A068U7Z09e-92A0A068U7Z0_COFCA; Uncharacterized protein
TrEMBLF6HZP92e-91F6HZP9_VITVI; Putative uncharacterized protein
STRINGVIT_07s0005g04120.t015e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45822139